We build
softwarepipelinesdatasystemsscrapersproductsthe future.that scale.

Data engineering, automation, and AI for operations that can't run on spreadsheets — web scraping at scale, ETL pipelines, machine learning, and custom dashboards, ERPs, and CRMs built around how your business actually works.

30+
Projects shipped
8+
Countries served
3+
Years in production
100%
Client satisfaction
Web scraping Data engineering Machine learning AI pipelines ETL systems Analytics Full-stack ERP · CRM Web scraping Data engineering Machine learning AI pipelines ETL systems Analytics Full-stack ERP · CRM
— What we do

Eight services, one data-first stack.

From flagship scrapers to ML systems and the full-stack software that wraps them. Pick a service or combine — we ship the whole thing.

— SELECTED WORK

Products we've shipped.

Real projects. Real impact. From legal tech to data engineering, we build products that solve complex problems at scale.

See our process
DATA ENGINEERING·LEGAL·PROPTECH

Connecticut Foreclosure Intelligence

Legal Tech · PropTech (United States)

Legal Tech / PropTech for US teams: 30+ court tables, priority case status, PDF equity extraction, property enrichment, and PostgreSQL loads with QA audit trails.

PropTech · Data engineering · MarTech

Property Data & Marketing Platform

PropTech · MarTech (United States)

PropTech / MarTech for US markets: 20+ automated sources, three-level lead matching, list cleaning, operations console, and CRM-ready webhooks — hundreds of thousands of properties across 15+ regions.

View case study

Data engineering · Legal

Judicial Scraper

LegalTech · AI for lawyers

Distributed scraping across TJSP, TJBA, TJRJ, and TRF3 — parallel headless browsers, SQLite persistence, ML audio CAPTCHA solving, and PDF ingestion.

View case study
Schema Therapy Journey
DIGITAL HEALTH·SAAS

Schema Therapy Journey

Safepath Institute

SaaS for therapists and patients: live iModes canvas, Alex AI exercises, WooCommerce onboarding, and admin ops — in production at schematherapyjourney.com.

Schema Therapy Journey

CragSoftware delivered beyond expectations. Their engineering quality and speed are rare to find.

Legal Operations Director
Legal Operations Director
Connecticut, USA
— How we think

We're not a software house. We're who solves your business problem with engineering.

You don't need another code vendor. You need someone who understands the problem, designs the right solution — and only then decides whether it becomes a scraper, a pipeline, an automation, or a new system. Code is the tool. The outcome is what matters.

30+hrs/week
Saved on average
Time our clients stop spending on manual work after the first month.
142+
Scrapers and automations in production
Running every day, with no manual intervention, for our clients.
99.94%uptime
Reliability
A system you forget exists — because it just works.
— Where we work

Data, across verticals.

We've shipped data systems for proptech, retail, finance, and lead-gen teams across three continents. Each vertical has its own quirks — we've learned them the hard way.

Real estate · proptech

Listings, prices, history

Cross-portal scrapers feeding brokerage tools, valuation models, and proptech platforms. Photos, geo, ownership signals — structured and deduped.

E-commerce · retail

Price & product intelligence

Competitor monitoring, catalog tracking, promo detection. Feed your pricing engine or merchandising team with fresh signal, not last week's CSV.

Finance · markets

Market & alternative data

Statements, filings, sentiment, public market data. Normalized for quant pipelines, research workflows, and internal dashboards.

Lead generation · B2B

Directories & enrichment

Targeted lead lists from public directories, social, and industry sites. Contact data, company signals, revenue cues — pipeline-ready.

— The team

Brazilian craft. International delivery.

A senior engineering team based in Brazil, shipping data systems for clients across the US, Europe, and Latin America. Async-first, English-fluent, production-minded — we build the same way agencies in London or New York do, without the agency overhead.

01

Senior engineers only

No juniors learning on your project. Every engagement is owned by someone who has shipped this kind of system in production before.

02

Async by default

Written updates, recorded walkthroughs, transparent repos. We work across timezones without burning anyone's calendar with status meetings.

03

Production from day one

Tested, documented, deployed. No prototypes dressed up as deliverables — what you get is the same code we'd run ourselves.

04

Transparent contracts

Fixed-price, retainer, or dedicated capacity. Scope is locked in writing before we start. No surprise invoices, no scope creep theatre.

— Why choose us

What makes us different.

No agency theater. Production engineering, clear ownership, structured contracts. The boring stuff that makes projects actually ship.

01

Deep data specialization

Web scraping, ETL pipelines, machine learning, and data systems are our core — not an add-on. Senior engineers with proven domain expertise across industries and markets.

02

Dedicated ownership

Every project has a dedicated engineer who owns delivery end to end. You always know who is accountable, where things stand, and what comes next — no ambiguity, no hand-offs.

03

Production-grade, every time

We hold production standards on every engagement. Clean architecture, tested, documented, and built to scale. No prototypes dressed up as deliverables.

04

Structured engagements

Fixed-price projects, retainer agreements, or dedicated engineering capacity. Structured contracts, clear milestones, delivery you can plan your roadmap around.

— AI applied

AI isn't the product. It's the accelerator.

We use AI where it actually saves time: reading documents, handling support, prioritizing, finding patterns in your data. No generic chatbot — implementation that changes what your team gets done.

Support and triage automation
Document extraction and reading
Models trained on your data, not generic ones
— How we work

Four steps. No mystery.

A predictable path from first message to deployed system. Clear scope, weekly progress, no surprises at the end.

01 · DISCOVERY

Discovery

You tell us what you need. We ask the right questions, understand the scope, and give you an honest estimate.

02 · PROPOSAL

Proposal

Clear scope, timeline, and price. No hidden fees, no surprises. You approve, we start.

03 · BUILD

Development

We build in sprints with regular updates. You see progress every week, not just at the end.

04 · DELIVER

Delivery & Support

We deploy, test, and hand everything over. Need changes or maintenance after? We are here.

— Tech stack

Right tool, right job.

We don't marry a stack — we pick what fits the problem. These are the ones we deploy most.

PythonTypeScriptGoRustJavaNext.jsReactVue.jsNode.jsFastAPINestJSSpring BootPostgreSQLMongoDBRedisSupabasePythonTypeScriptGoRustJavaNext.jsReactVue.jsNode.jsFastAPINestJSSpring BootPostgreSQLMongoDBRedisSupabase
FirebaseAWSDockerKubernetesVercelOpenAILangChainSeleniumPlaywrightPuppeteerGraphQLPrismaStripedbtBigQueryAirflowFirebaseAWSDockerKubernetesVercelOpenAILangChainSeleniumPlaywrightPuppeteerGraphQLPrismaStripedbtBigQueryAirflow
— Client feedback

Trusted worldwide.

From São Paulo to Amsterdam, from Paris to New York. We ship software for teams that need data to move.

They built our entire CRM in half the time we expected. Clean code, zero drama, and they actually understood what we needed from day one.

JM
James Mitchell · US
CTO, Parkfield Digital

We needed a web scraper that could handle serious volume and they delivered exactly that. Fast, solid, and it just works.

SC
Sarah Collins · UK
Founder, Bloom Analytics

MVP to production in weeks. They get the startup pace and don't cut corners. Best engineering team we've hired.

DP
David Park · US
Product Lead, NovaTech

Their automation saved us over 30 hours a week. First month in and we already saw the ROI.

EW
Emily Watson · US
Ops Director, Freight Hub

They delivered our ERP ahead of schedule. The quality was above what we expected, and I would recommend them without hesitation.

RO
Ricardo Oliveira · BR
CEO, Metalúrgica Horizonte

They built an AI integration for our support flow and our response time dropped by 60%.

CS
Camila Santos · BR
IT Director, Grupo Vertice

They built our full bot system with AI integration. Delivered quickly, works reliably, and there was zero hassle.

DB
Daan van der Berg · NL
CTO, FlowStack

They built us a custom CRM in record time. The code is clean and it is obvious they know exactly what they are doing.

MH
Martín Herrera · AR
CEO, Cúspide Digital

They built our entire CRM in half the time we expected. Clean code, zero drama, and they actually understood what we needed from day one.

JM
James Mitchell · US
CTO, Parkfield Digital

We needed a web scraper that could handle serious volume and they delivered exactly that. Fast, solid, and it just works.

SC
Sarah Collins · UK
Founder, Bloom Analytics

MVP to production in weeks. They get the startup pace and don't cut corners. Best engineering team we've hired.

DP
David Park · US
Product Lead, NovaTech

Their automation saved us over 30 hours a week. First month in and we already saw the ROI.

EW
Emily Watson · US
Ops Director, Freight Hub

They delivered our ERP ahead of schedule. The quality was above what we expected, and I would recommend them without hesitation.

RO
Ricardo Oliveira · BR
CEO, Metalúrgica Horizonte

They built an AI integration for our support flow and our response time dropped by 60%.

CS
Camila Santos · BR
IT Director, Grupo Vertice

They built our full bot system with AI integration. Delivered quickly, works reliably, and there was zero hassle.

DB
Daan van der Berg · NL
CTO, FlowStack

They built us a custom CRM in record time. The code is clean and it is obvious they know exactly what they are doing.

MH
Martín Herrera · AR
CEO, Cúspide Digital
— Book a call

Ready to build
your next project?

30 minutes, zero pressure. Tell us what data you need or what you are building and we will tell you exactly how we can help.

No commitment required
100% free consultation
Response within 24 hours
— Get in touch

Let's work
together.

Tell us about your project. We will get back to you within 24 hours with an honest assessment and a path forward.

WhatsApp: +55 48 99997-9220

Based in
Brazil
International team
Response time
< 24 hours
From first message
Engagement
Fixed · retainer
Or dedicated capacity
Markets
8+ countries
US · EU · LATAM
Name
Email
Company
Message